Protein Info for Shew_2034 in Shewanella loihica PV-4

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 5 to 186 (182 residues), 102.2 bits, see alignment E=2.7e-33 PF13561: adh_short_C2" amino acids 14 to 237 (224 residues), 111.3 bits, see alignment E=5.9e-36

Best Hits

KEGG orthology group: K03793, pteridine reductase [EC: 1.5.1.33] (inferred from 100% identity to slo:Shew_2034)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEK2 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Shew_2034 short-chain dehydrogenase/reductase SDR (RefSeq) (Shewanella loihica PV-4)
MTMNKWALVTGGAKRIGEAIVLALHGKGFNILLHYKGSESEAMALAGKLNLSRVNSCQTV
QADLATEQGPLSLIQHINDHQLPLGALINNASLFVPDSSIENWQSSQQLLNLNLLAPYLL
ATKLSENLASNDGCVINLVDIHGDRPLKRHGLYSISKAGLNMATRSLAQELAPKVRVNGI
SPGAILWPSQSEQAAISSVTQAIPLARAGSPEDIADTVCFILESPYLNGQVIAIDGGRSA
TGYTGADG