Protein Info for Shew_2031 in Shewanella loihica PV-4

Annotation: translation initiation factor IF-3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF05198: IF3_N" amino acids 9 to 79 (71 residues), 96.5 bits, see alignment E=8.1e-32 TIGR00168: translation initiation factor IF-3" amino acids 14 to 173 (160 residues), 231 bits, see alignment E=3e-73 PF00707: IF3_C" amino acids 86 to 171 (86 residues), 129.1 bits, see alignment E=5e-42

Best Hits

Swiss-Prot: 90% identical to IF3_SHEWM: Translation initiation factor IF-3 (infC) from Shewanella woodyi (strain ATCC 51908 / MS32)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to slo:Shew_2031)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEJ9 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Shew_2031 translation initiation factor IF-3 (RefSeq) (Shewanella loihica PV-4)
MRKAAANRINELIVGVSEVRLNGLDGETIGIVSLREAQELADEAGVDLVEISPNAEPPVC
RIMDYGKYLFDKAKAQKEQKKKQKQIQVKEIKFRPGTDENDYQVKLRNLKRFLEDGDKAK
VTLRFRGREMAHQSLGMNLLNRIKDDLAEIAVVEAFPKMEGRQAVMVLAPKKK