Protein Info for Shew_2027 in Shewanella loihica PV-4

Annotation: NAD(P) transhydrogenase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF01262: AlaDh_PNT_C" amino acids 9 to 220 (212 residues), 295.3 bits, see alignment E=8.4e-92 PF01488: Shikimate_DH" amino acids 34 to 137 (104 residues), 35 bits, see alignment E=5e-12 PF07992: Pyr_redox_2" amino acids 35 to 87 (53 residues), 29.4 bits, see alignment E=1.9e-10 PF02826: 2-Hacid_dh_C" amino acids 35 to 136 (102 residues), 29 bits, see alignment E=2.3e-10 PF02737: 3HCDH_N" amino acids 38 to 90 (53 residues), 22.7 bits, see alignment E=2.9e-08 PF00070: Pyr_redox" amino acids 38 to 85 (48 residues), 27.3 bits, see alignment 1.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2027)

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.1

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEJ5 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Shew_2027 NAD(P) transhydrogenase subunit alpha (RefSeq) (Shewanella loihica PV-4)
MSEVAGRMSIQAGAMALEKSMGGRGMLLGGVPGVEPAKVVIIGGGMVGTNAAQMAVGLGA
DVVILDRSIDALRRLNAQFDNRVKAIYSTADAIEKHVLEADLVIGGVLVPGAAAPKLVTK
DHIKRMKPGSAIVDVAIDQGGCVETSHATTHQDPTYIVDEVVHYCVANMPGAVARTSTFA
LNNATLPYIIKLADMGYREALRQDKHLLNGLNVMHGKVTCKEVAEALNFEFVDPSVLLA