Protein Info for Shew_2021 in Shewanella loihica PV-4
Annotation: CrcB protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CRCB_SHELP: Putative fluoride ion transporter CrcB (crcB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)
KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to slo:Shew_2021)MetaCyc: 38% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498
Predicted SEED Role
"CrcB protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QEI9 at UniProt or InterPro
Protein Sequence (124 amino acids)
>Shew_2021 CrcB protein (RefSeq) (Shewanella loihica PV-4) MNNLIFVALGGSIGAVFRYLISIFMIQVFGSSFPFGTLMVNVIGSFLMGVIYALGEASQV SPEIKALVGVGLLGALTTFSTFSNETLLLMQQGAWLKAFTNIALNLCLCLFMVYLGQQLV FSRI