Protein Info for Shew_2012 in Shewanella loihica PV-4

Annotation: inner membrane transport protein YdhC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 6 to 397 (392 residues), 269.8 bits, see alignment E=2.5e-84 PF07690: MFS_1" amino acids 13 to 365 (353 residues), 142.9 bits, see alignment E=6.2e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2012)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEI0 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Shew_2012 inner membrane transport protein YdhC (RefSeq) (Shewanella loihica PV-4)
MNKIAKFSFLIYLALLSMLGFIATDMYLPAFKAIETSLDASATQVASSLTFFLAGLALGQ
LLYGPLVQAIGKRLSLVLGLVLFGAASLVIANSDSIAMFNVARFFQALGACSASVIWQAI
VIDRYKASEAQQVFSNIMPLVALSPALAPILGAYLLEWQQWHSIFFILGGLSLLLILATL
AWVESKESLNSKADEAISQQGSTDTQVQKSVRVSYLAMLASPRYLGNVLIFGACSAAFFS
YLTLWPIVMEQHGYEAKAIGLSFIPQTVMFILGGYLSKLFIRRLGAEVTLTWVLLLFGAC
VAGIALVTLCYPSSTIWPLLSIFSVMAAANGACYPIVVNSALQVFKQASAKAAGLQNFLQ
ISIAFGASSLVALWASSGEKAIGVGIVVSAIGVLIGFQVRGYDKWRAVFGAISPPDPAKI
ALHQEEDSTK