Protein Info for Shew_2000 in Shewanella loihica PV-4

Annotation: glyceraldehyde-3-phosphate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF00044: Gp_dh_N" amino acids 128 to 238 (111 residues), 70.1 bits, see alignment E=1.8e-23 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 129 to 461 (333 residues), 367.5 bits, see alignment E=3.3e-114 PF02800: Gp_dh_C" amino acids 293 to 450 (158 residues), 141.6 bits, see alignment E=1.7e-45

Best Hits

Swiss-Prot: 62% identical to GAP2_PSEAB: Glyceraldehyde-3-phosphate dehydrogenase-like protein (gap2) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to slo:Shew_2000)

Predicted SEED Role

"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEG8 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Shew_2000 glyceraldehyde-3-phosphate dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MTADKHLQSWQERFEMAEAMQPLLGKLYRNQGVEVVLYGKPLLNASTIEIIKSHRLVRRH
VGDKLRLRESFPFVEALSKLAVKQCKVDIGKLAVNYWREHKDASQIEAYMSQELASAIDH
EDNQEARDVVLYGFGRIGRLLARLLIERTGVSNKLRLRAIVLRGGRKGDLEKRASLLRRD
SVHGPFNGSVEVDEENNAIIANGTYIQVIYANSPDEVDYTRYGINNALVVDNTGIWKDED
GLGLHLRCNGASKVLLTAPAKGAIKNIVYGVNENDILDEDTIVSAASCTTNAITPVLKAV
NDKYGIVNGHVETIHSYTNDQNLIDNYHKADRRGRSAPLNMVITETGAAKAVAKALPVLA
GKLTGNAIRVPTPNVSMAIISLNLNGETSKEDMNEYLRNVALCSELQNQVDFTESTEIVS
SDLVGSRYAGVVDSQATIAEGNRAILYVWYDNEFGYSCQVVGVMQKMLGLNYQSLPAA