Protein Info for Shew_1998 in Shewanella loihica PV-4

Annotation: protein of unknown function UPF0052 and CofD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF01933: CofD" amino acids 12 to 285 (274 residues), 243.8 bits, see alignment E=1.1e-76 TIGR01826: conserved hypothetical protein" amino acids 12 to 259 (248 residues), 318.8 bits, see alignment E=2.1e-99

Best Hits

Swiss-Prot: 57% identical to GNGF_ECOLI: Putative gluconeogenesis factor (ybhK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1998)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEG6 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Shew_1998 protein of unknown function UPF0052 and CofD (RefSeq) (Shewanella loihica PV-4)
MRDCAINQYQHVVAIGGGHGLGRVLSSLSFLGPKLTGIVATTDNGGSTGRLRQQQDCIAW
GDLRNCLSQLASRPSVGSLLFEYRFGGNSELANHNLGNLVLMALDDLCVRPLDAVNLIRK
LLNIETKVIPMSEQPTHLVAIQSCGNRIFGEVEVDQKCEDPIALSLEPMVGATLEACEAV
RQADLIILGPGSFLTSIMPPLLLPKLAEALHASKAKVILIDNLTQEPSAAANFSLEKRLG
WFKQVMGNKAVDHVLCHGDRYLTTGIVTHYPLRSRHHQALHDRAALADALSLIVEPQALD
ALA