Protein Info for Shew_1997 in Shewanella loihica PV-4

Annotation: bax protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF01832: Glucosaminidase" amino acids 149 to 277 (129 residues), 54.3 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: K03796, Bax protein (inferred from 100% identity to slo:Shew_1997)

Predicted SEED Role

"Putative Bax protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEG5 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Shew_1997 bax protein, putative (RefSeq) (Shewanella loihica PV-4)
MTYNAAHELIIRAKHLRTGHINKLILSLGIVALAVLAVKLFLIERKTEPDQAPGTILKNR
SQFSAIPDFQAIGDVGMKKQAFFDFLRPAIRHHNAVISDERKFLEQSRTHLANQQPLSEA
EDYRILQLASKYQYSMRTATLESLDELLTRVDTIPEDLVLIQAANETGWGSSRFAREGMN
FFGQWCFKKGCGLVPQSRSEGLSHEVAVFKSVEDSVGSYMRNLNSNAAYSLLRAIRADLR
AQNQPVSAEKLVYGLMNYSERQEAYVEELLDMLRHNNQFLVENHEQRPAV