Protein Info for Shew_1994 in Shewanella loihica PV-4

Annotation: universal stress protein UspE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00582: Usp" amino acids 4 to 146 (143 residues), 82 bits, see alignment E=3.3e-27 amino acids 174 to 299 (126 residues), 65.2 bits, see alignment E=4.8e-22

Best Hits

Swiss-Prot: 52% identical to USPE_YERPE: Universal stress protein E (uspE) from Yersinia pestis

KEGG orthology group: K14055, universal stress protein E (inferred from 100% identity to slo:Shew_1994)

Predicted SEED Role

"Universal stress protein E" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEG2 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Shew_1994 universal stress protein UspE (RefSeq) (Shewanella loihica PV-4)
MKDYHKILVVVDPTSDKQSALARAVELASKNQASITVFLSIFDFSYEMTSILSGHEREAM
RQGVIAQRRAWLDDILGGYKDSGVAIDSEVIWHNRPFESIILHAIEGSYDLIVKGTHEHD
KLKSVIFTPTDWHLMRKAPVPVLLVKEHDWPVAGKILCAINVASEDDDHQTLNGKIIEHA
LDLAKKFDAQVHLVNGYPGTPVNLAIELPDFDAHTYSETIRMQHEQRVCYLASNYGISSD
FCHIKEGLPEDVIPELAEQLDAELVILGTVGRTGFSAALIGNTAEHVIDSINCDLLAIKP
DGYKSPLEEE