Protein Info for Shew_1986 in Shewanella loihica PV-4

Annotation: cytochrome c oxidase, cbb3-type, subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details TIGR00781: cytochrome c oxidase, cbb3-type, subunit II" amino acids 5 to 182 (178 residues), 279.9 bits, see alignment E=8.6e-88 PF02433: FixO" amino acids 5 to 181 (177 residues), 275.2 bits, see alignment E=3.7e-86

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to slo:Shew_1986)

MetaCyc: 73% identical to cbb3-2 cytochrome c oxidase subunit O (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEF4 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Shew_1986 cytochrome c oxidase, cbb3-type, subunit II (RefSeq) (Shewanella loihica PV-4)
MKFNHEIVEKNIGLLGIFTVIAISIGGLVQITPLLFQKDTTEPVNGLRPYSALELEGRDI
YIREGCVGCHSQMIRPLRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGGRYSDK
WHEVHLLDPRAVVPQSNMPAFPWLAENVLDGELTAKKMEVFRGFGVPYSQDDIDNAKKAV
EGKTEMQALIAYLQSLGHALK