Protein Info for Shew_1961 in Shewanella loihica PV-4

Annotation: acyl-CoA dehydrogenase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF02771: Acyl-CoA_dh_N" amino acids 42 to 159 (118 residues), 45.5 bits, see alignment E=2.7e-15 PF02770: Acyl-CoA_dh_M" amino acids 163 to 269 (107 residues), 69.2 bits, see alignment E=8.5e-23 PF00441: Acyl-CoA_dh_1" amino acids 279 to 441 (163 residues), 73 bits, see alignment E=9.2e-24 PF22924: ACOX_C_alpha1" amino acids 288 to 438 (151 residues), 37.4 bits, see alignment E=7.2e-13 PF08028: Acyl-CoA_dh_2" amino acids 295 to 437 (143 residues), 24.1 bits, see alignment E=1.2e-08 PF12806: Acyl-CoA_dh_C" amino acids 479 to 578 (100 residues), 77 bits, see alignment E=4.3e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1961)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEC9 at UniProt or InterPro

Protein Sequence (583 amino acids)

>Shew_1961 acyl-CoA dehydrogenase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MNPYQAPLADMKFLLERVFDAPQTWGELAALAETVDMDTATAILDEAEKISRDLIHPINR
PGDEQGVSFEDAKVITPDGYREVYDQYAEGGWVGLCGDPEFGGMGMPKMLGVLVDEMAYS
ACNAFTLYGSLTAGAALCINAHGSDELKEKYLPNLYSGQWAGAMDMTEPQAGSDLRNIRT
KAIPQDDGSYLISGSKIFITGGDHDLTENVIHLVLAKLPDSNGISLFLVPKIKVDDNGEL
GETNGVTVGSIEHKMGLKGSATCVMNFDDAQGYLIGKANRGLVCMFTMMNYERLAIGIQG
LGTSQAAYQMASDYAKERLQGQAAGGSDNASDPILVHGDVRRMLMTIRCYTEAGRALSVF
TGQQLDLAKHAEGEVQEKAARYVGLLTPVAKAFLSDRGLDAAVMAQQVFGGHGYIRETGI
EQLVRDTRIAQIYEGTNGIQAVDFLGRKTTGDDLRTLTEFVGECQSRLAAMTHVTDAQKA
LITSRFDALLASGEYINANKLSNPALINACAVDFLDAFGHLIYGYFWLLMADRAADHQDA
SFSTAKQQLADFYLAKLLPKVDYHLAQVNAGDASVMAMAEELF