Protein Info for Shew_1937 in Shewanella loihica PV-4

Annotation: peptidase M14, carboxypeptidase A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF18027: Pepdidase_M14_N" amino acids 3 to 109 (107 residues), 134.5 bits, see alignment E=1.6e-43 PF00246: Peptidase_M14" amino acids 129 to 342 (214 residues), 82.9 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 49% identical to Y1242_ZYMMO: Uncharacterized protein ZMO1242 (ZMO1242) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1937)

Predicted SEED Role

"Zinc carboxypeptidase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEA5 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Shew_1937 peptidase M14, carboxypeptidase A (RefSeq) (Shewanella loihica PV-4)
MLISANFDGGNIEVINQDDINNVQLAIRPDEGGEFFQWFNFRLQGEVGQRYTLNIINAGQ
ASYTKGWEDYQAAATYDRQQWFRLPTQYQDGKLTIEVELDCEMIQIAYFAPYSYERHQDL
LSAVQVHPLVSLEHLGKTLDDRDMTLVKVGDEDEEKAKIWITARQHPGETMAEWLVEGLL
NNLLDGDCPTAKALLDKANFYIVPNMNPDGGVRGHLRTNAKGVNLNREWQSPSLEKSPEV
YHVVNRMKETGVDLYYDVHGDEGLPYVFLAGCEGVPGYNQKMADLQGDFVKALLMASADF
QDEFGYDKDEPGQANLTVASNWVAQTFGCLSNTLEMPFKDNANMPDPMSGWSPERCIYLG
EASLLAMLAVVDKLR