Protein Info for Shew_1931 in Shewanella loihica PV-4

Annotation: alkylphosphonate utilization operon protein PhnA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08274: Zn_Ribbon_YjdM
  • amino acids 4 to 33 (30 residues), 52.8 bits, E=3.1e-18
• TIGR00686: putative alkylphosphonate utilization operon protein PhnA
  • amino acids 5 to 112 (108 residues), 153.3 bits, E=1.2e-49
• PF03831: YjdM
  • amino acids 47 to 113 (67 residues), 98.6 bits, E=1.5e-32

Best Hits

Swiss-Prot: 62% identical to YJDM_SHIFL: Protein YjdM (yjdM) from Shigella flexneri

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 100% identity to slo:Shew_1931)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• phosphonoacetate degradation (1/1 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

See A3QE99 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Shew_1931 alkylphosphonate utilization operon protein PhnA (RefSeq) (Shewanella loihica PV-4)
MSDTIPPCPKCESPYAYEDGSLLICPECAHEWNPNEVAVDPDAIILKDAVGNLLEEGDKV
TLIKDLKVKGTSLTLKVGTKAVINRFVDADHDIDCKVDGHGQMMLKSKFVKKQS