Protein Info for Shew_1926 in Shewanella loihica PV-4

Annotation: transketolase, central region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF02779: Transket_pyr" amino acids 3 to 179 (177 residues), 148 bits, see alignment E=2.2e-47 PF02780: Transketolase_C" amino acids 195 to 312 (118 residues), 133.8 bits, see alignment E=3.2e-43

Best Hits

Swiss-Prot: 68% identical to ODBB_DICDI: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial (bkdB) from Dictyostelium discoideum

KEGG orthology group: K00167, 2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC: 1.2.4.4] (inferred from 100% identity to slo:Shew_1926)

MetaCyc: 64% identical to branched-chain alpha-keto acid decarboxylase E1-beta subunit (Arabidopsis thaliana col)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE94 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Shew_1926 transketolase, central region (RefSeq) (Shewanella loihica PV-4)
MAKINMLQAINDALTIAMETDDKAVIFGEDVGHFGGVFRATSGLQDKFGRDRCFNTPLTE
QGIAGFANGLASNGMTAIAEIQFADYIFPAFDQIVNESAKFRYRSGNEFNVGGITYRTPY
GGGIAGGHYHSQSPEAYFTQTPGLKVVVPRNAYQAKGLLLASIRDKNPVVFFEPKRLYRA
SVGEVPDEAYEIELGKAEVVQEGTDITVLAWGAQMEIVEEAAKMAAKKGISCEVIDLRTL
APWDVDTVAASVKKTGRLVINHEAPLTGGFAGEIAATIQQECFLYLESPISRVCGLDTPY
PLIHEKEYMPDALKTFEAIKASMKY