Protein Info for Shew_1915 in Shewanella loihica PV-4

Annotation: elongation factor P (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF08207: EFP_N" amino acids 3 to 60 (58 residues), 72.5 bits, see alignment E=3.2e-24 TIGR00038: translation elongation factor P" amino acids 3 to 186 (184 residues), 207.1 bits, see alignment E=8.8e-66 PF01132: EFP" amino acids 65 to 124 (60 residues), 62.9 bits, see alignment E=3e-21 PF09285: Elong-fact-P_C" amino acids 130 to 185 (56 residues), 67.4 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 100% identical to EFP_SHELP: Elongation factor P (efp) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to slo:Shew_1915)

MetaCyc: 36% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE83 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Shew_1915 elongation factor P (RefSeq) (Shewanella loihica PV-4)
MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKMKLKNLLQESSTETTFKGEDKM
EDIILDRLDCTYSYFADPMYVFMDAEYNQYDVEADNLGDAAAYIVDGMEEQCQVTFYEGK
AISVELPTTVVREVTYTEPSARGDTSGKVMKPATIAGGATLSVADFVKTGDLIEIDTRTH
EFKKRA