Protein Info for Shew_1912 in Shewanella loihica PV-4

Annotation: deoxyguanosinetriphosphate triphosphohydrolase-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR01353: putative dGTPase" amino acids 21 to 431 (411 residues), 400.4 bits, see alignment E=6.3e-124 PF01966: HD" amino acids 59 to 119 (61 residues), 28.1 bits, see alignment E=2.2e-10 PF13286: HD_assoc" amino acids 337 to 427 (91 residues), 95.4 bits, see alignment E=2.4e-31

Best Hits

Swiss-Prot: 100% identical to DGTL1_SHELP: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (Shew_1912) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to slo:Shew_1912)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE80 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Shew_1912 deoxyguanosinetriphosphate triphosphohydrolase-like protein (RefSeq) (Shewanella loihica PV-4)
MTSAIWHERRLGEEKLRRNDHRSPYQRDRARILHSAAFRRLQAKTQVLGVGMNDFYRTRL
THSLEVSQIGTGICAQLKQKYPDLHHLLDSMSLIESLCLAHDIGHPPFGHGGEVALNYMM
RSDGGFEGNGQTFRILTALEPYTQHFGMNLTRRTLLGILKYPASHNELYQSQPRPEVDSY
RQLKPSQWRPVKGIFFEDKPVLDWVLEPLSTQDRERFVSAEPGERDQHRRTRYKSLDCSI
MELADDTAYAIHDLEDAIVMGIVTQAMWQQDVSSLLAGSDDEWIAKEFATIGDKLFALEN
HLRKDAIGTLVNGFVTAILIDENPNFIEPLLRYNARLEPPFAEALHVLKQFVYKRVIRKP
EIQMLEYKGQQIVMELFEAFASDPERLLPLNTQERWQQMAQQEGNCNRVIADYISGMTDE
FAARLHQHLFSAKAGSLIDLQ