Protein Info for Shew_1903 in Shewanella loihica PV-4

Annotation: para-aminobenzoate synthase, subunit I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF04715: Anth_synt_I_N" amino acids 18 to 165 (148 residues), 87.6 bits, see alignment E=9.4e-29 TIGR00553: aminodeoxychorismate synthase, component I" amino acids 122 to 469 (348 residues), 393.4 bits, see alignment E=4e-122 PF00425: Chorismate_bind" amino acids 215 to 467 (253 residues), 304 bits, see alignment E=1e-94

Best Hits

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 100% identity to slo:Shew_1903)

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE71 at UniProt or InterPro

Protein Sequence (477 amino acids)

>Shew_1903 para-aminobenzoate synthase, subunit I (RefSeq) (Shewanella loihica PV-4)
MDFSSTQGVALQKLDWQLSTIEVFDCFAHLPWAILLDSAGADHIDARYDIISFDPLATIT
SQDGVTHTRHLRPTAASATEENQSKDGVEISQDDPLSILQAAIADYFPTQHACELPFSGG
ALGTFSYDLGRRIEKLPTIAAQDIELPEMNIGLYDWALLFCYQSQTWSLVHYRGETALKE
RLADLEARLSSPSNEKANGEKFALSRDWQPQITKGEYRDKFDRVQDYLHSGDCYQINLTQ
RFEAEYRGDEWQAYLKLRASNKAPFSAFIRLDMHAILSISPERFIKLKGDAIETKPIKGT
MARSSDATADKAAAEALAASEKDRAENLMIVDLLRNDIGKVASPGSVRVPHLFAIESFPA
VHHLVSTVTANLAAPNSPCDLLRAAFPGGSITGAPKIRAMEIIEELEPSRRSLYCGSIGY
ISQDRQMDTSITIRTLVAEPPRLYCWAGGGIVADSQVDAEYQESYDKVSKILPVLSN