Protein Info for Shew_1847 in Shewanella loihica PV-4

Annotation: amino acid-binding ACT domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 40 to 56 (17 residues), see Phobius details PF13740: ACT_6" amino acids 4 to 78 (75 residues), 83.6 bits, see alignment E=3.5e-28

Best Hits

Swiss-Prot: 37% identical to GCVR_SHIFL: Glycine cleavage system transcriptional repressor (gcvR) from Shigella flexneri

KEGG orthology group: K03567, glycine cleavage system transcriptional repressor (inferred from 100% identity to slo:Shew_1847)

Predicted SEED Role

"Glycine cleavage system transcriptional antiactivator GcvR" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE15 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Shew_1847 amino acid-binding ACT domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSNHLVVTALGSDRPGIVSKFARLASECDCDIVDSRMALFGGEFTLIMMISGAWASITKM
EASLPALSVELGLLTVMKRCSQHTPPNYVSRLEVTFNGKDQRGTMKRITQFLADRSLDLA
AVRSHAEETPDGEPVQNVFLTINVPEKVDIEKLEQNIAALAEEMNLSCHIERMQGIETQP
KDDL