Protein Info for Shew_1846 in Shewanella loihica PV-4

Annotation: redoxin domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF08534: Redoxin" amino acids 6 to 141 (136 residues), 100.4 bits, see alignment E=1.2e-32 PF00578: AhpC-TSA" amino acids 7 to 134 (128 residues), 138 bits, see alignment E=2.4e-44 PF02630: SCO1-SenC" amino acids 11 to 111 (101 residues), 30 bits, see alignment E=6.9e-11

Best Hits

Swiss-Prot: 61% identical to BCP_HAEIN: Putative peroxiredoxin bcp (bcp) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 100% identity to slo:Shew_1846)

MetaCyc: 56% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE14 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shew_1846 redoxin domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MKTLTQGDKAPDFTLQNQNDESVSLADFKGKKVLVYFYPRASTPGCTVQACGLRDTKSEL
DELNVVIIGISPDTPKKLTNFTNKQELNFTLLADEEHAVCEAYGVWQLKKFMGRENMGVV
RTSFLIDESGNIEHIFNKFKTKDHHEVVLKYIQENS