Protein Info for Shew_1841 in Shewanella loihica PV-4

Annotation: peptidase M48, Ste24p (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 162 to 177 (16 residues), see Phobius details PF01435: Peptidase_M48" amino acids 72 to 258 (187 residues), 111.2 bits, see alignment E=5.5e-36 PF14559: TPR_19" amino acids 353 to 410 (58 residues), 26.3 bits, see alignment 7.6e-10

Best Hits

Swiss-Prot: 45% identical to BEPA_ECOLI: Beta-barrel assembly-enhancing protease (bepA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1841)

MetaCyc: 45% identical to beta-barrel assembly-enhancing protease (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"Exported zinc metalloprotease YfgC precursor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE09 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Shew_1841 peptidase M48, Ste24p (RefSeq) (Shewanella loihica PV-4)
MSKVNKAKSLVAGALSMALFSIAPLGFANNDLPDLGTAAVNTFSLEKENSYGDAYMRVIR
SSAPMLNDPVLNQYLTELGNRLVAHATGVKTPFYFFLLRNDEINAFAFFGGHVGVHTGLF
LNADNESQLASVLGHEITHVTQRHLARSLEAQQKSSPATIAGLLGAILLTIAVPQVGMAA
MATTQALATQAQINYTRLHEKEADRIGMQILVDAGFDPNGAADFFSKLATRYRFTTKPPQ
MLLTHPLPESRIAEARNRAAQYPHRYVADNLDFQLAKARIQVRFSSYSEEAALALFNDQI
RKNSYQFEEAALYGKALALLRAEKAKESEIIIDKLLAKDPNNLFYIDTKTDLLLERHEHQ
QAIDLLTRERKLKPTSQVININLANALIENGKAKQAIPLLEDMIFLDKQNQLPLQLLSDA
YKQTGNRAMEHFAKAETMALAADYDGAIDQLNFAYRLSEKNPLQLAKIEARIRQFKQSKK
QLELL