Protein Info for Shew_1836 in Shewanella loihica PV-4

Annotation: uracil-xanthine permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 7 to 9 (3 residues), see Phobius details transmembrane" amino acids 10 to 26 (17 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details amino acids 382 to 399 (18 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 8 to 398 (391 residues), 375 bits, see alignment E=2.4e-116 PF00860: Xan_ur_permease" amino acids 9 to 374 (366 residues), 323.1 bits, see alignment E=1.1e-100

Best Hits

KEGG orthology group: K02824, uracil permease (inferred from 100% identity to slo:Shew_1836)

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE04 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Shew_1836 uracil-xanthine permease (RefSeq) (Shewanella loihica PV-4)
MKRLAIPLQGAQMLFVAFGALVLMPLLTGLDTNVALFTAGIGTLLFQLVTKRQVPIFLAS
SFAFIAPILYGVQTWGIPATMGGLMAAGCVYLVLATLVKFRGDAFIKRLLPPVVVGPVII
VIGLGLAPVAVNMALGKSGDGGLVLVDPEHALIISLASLLTTIAVAIFAKGIVKLMPILA
GIIVGYGLSLFFGVVDFAPVAQASWLAMPNFVAPEFNWHAIAFMIPVAIAPAVEHIGDIL
AISNVTGKDYMKKPGLHRTLSGDGIATIAASALGGPPNTTYSEVTGAVTLTKAFNPAIMT
WTAITAILLAFIGKLGALMQTIPVPVMGGIMCLLFGSIAAVGLNSLIKNHVDLSEPRNLC
IVGVTLVFGIGGMAFGIGSFSLTGISLCGIVAITMNLLLPETHARQEQEVA