Protein Info for Shew_1834 in Shewanella loihica PV-4

Annotation: superoxide dismutase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 82 (80 residues), 113 bits, E=7.3e-37
• PF02777: Sod_Fe_C
  • amino acids 90 to 190 (101 residues), 139.4 bits, E=3.9e-45

Best Hits

Swiss-Prot: 82% identical to SODF_PHOLE: Superoxide dismutase [Fe] (sodB) from Photobacterium leiognathi

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to slo:Shew_1834)

MetaCyc: 74% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See A3QE02 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Shew_1834 superoxide dismutase (RefSeq) (Shewanella loihica PV-4)
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLVEGTELAEKSLEEIVKTS
TGGIFNNAAQIWNHTFYWNCLAPNAGGAATGDIAAAIDAAFGSFDAFKAQFTDAAVNNFG
SAWTWLVKKADGSLAIVNTSNAATPLTDEGVTPLLTVDVWEHAYYIDYRNVRPDYMAAFW
NLVNWEFVNSNFAA