Protein Info for Shew_1825 in Shewanella loihica PV-4

Name: uvrC
Annotation: excinuclease ABC subunit C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 TIGR00194: excinuclease ABC subunit C" amino acids 9 to 587 (579 residues), 660.7 bits, see alignment E=1.1e-202 PF01541: GIY-YIG" amino acids 18 to 93 (76 residues), 37 bits, see alignment E=1.2e-12 PF27096: UvrC_M" amino acids 102 to 194 (93 residues), 91.1 bits, see alignment E=1.9e-29 PF02151: UVR" amino acids 204 to 237 (34 residues), 36.6 bits, see alignment (E = 9.7e-13) PF22920: UvrC_RNaseH" amino acids 250 to 367 (118 residues), 103.6 bits, see alignment E=2.3e-33 PF08459: UvrC_RNaseH_dom" amino acids 384 to 541 (158 residues), 165.6 bits, see alignment E=3e-52 PF14520: HHH_5" amino acids 556 to 608 (53 residues), 40.6 bits, see alignment 1e-13

Best Hits

Swiss-Prot: 100% identical to UVRC_SHELP: UvrABC system protein C (uvrC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to slo:Shew_1825)

MetaCyc: 58% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDZ3 at UniProt or InterPro

Protein Sequence (609 amino acids)

>Shew_1825 excinuclease ABC subunit C (RefSeq) (Shewanella loihica PV-4)
MTDSFNATQFLKTVSSSAGVYRMYDAQGVVIYVGKAKDLKKRLSSYFRRNLPNVKTQALV
SHIANIDVTLTPSETDALILENDYIKQYMPRYNVLLRDDKSYPYIFLSGHRHPRLAYHRG
PQREKGHYFGPYPNGGAVRESLHLMQKLFPIRQCDDLYYKARSRPCLQYQIARCSAPCVG
KISDEDYAEQVKLASLFLRGKDQQVIATLVGKMEQAAMDLNYEDAARYRDQISALRRVAE
QQEVSSDSGDMDVIGAYYASGIACFHLLFIRNGKIFGSRSYYPSVPDETEVSEVLRAFML
QFYLNVDSQRTLPREIVVSHEFEDIHELEEAIAQASNRRLLIKTKVRSERASFLRIADAN
AKNAVETRLSHQNTVEERFLLLEEALEQSQAINRMECFDISHTMGESTVASCVVFNREGP
SKGEYRRYNISGITPGDDYAAMKQAIGRRFDKIEADGKIPDILFIDGGMGQLRIAQKVVN
EKFAHLDVAPTLIGVAKGEGRKPGLETLIYGENEVAFSLPADSGALHLIQHIRDESHRFA
ITGHRNKRQKTRNTSTLESIPGVGPKRRKALLQYLGGLQQVKGASVAQLSKVPGISLEMA
QTIHDALRG