Protein Info for Shew_1812 in Shewanella loihica PV-4

Annotation: 23S rRNA m(2)G2445 methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 PF22020: RlmL_1st" amino acids 3 to 57 (55 residues), 49.2 bits, see alignment 2.2e-16 PF02926: THUMP" amino acids 68 to 152 (85 residues), 46.3 bits, see alignment E=2.5e-15 PF01170: UPF0020" amino acids 162 to 371 (210 residues), 177.1 bits, see alignment E=2e-55 PF10672: Methyltrans_SAM" amino acids 462 to 667 (206 residues), 93.8 bits, see alignment E=6e-30 PF03602: Cons_hypoth95" amino acids 545 to 637 (93 residues), 36.2 bits, see alignment E=2.8e-12 PF13847: Methyltransf_31" amino acids 546 to 670 (125 residues), 33 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 100% identical to RLMKL_SHELP: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to slo:Shew_1812)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDY0 at UniProt or InterPro

Protein Sequence (711 amino acids)

>Shew_1812 23S rRNA m(2)G2445 methyltransferase (RefSeq) (Shewanella loihica PV-4)
MLNFFAAAPRGYEYALSLELAEFGAAEIKESVAGVYFSAPLNLAYRITLWSRLASRIILV
IYKGPCENPEQLYNAAYCIDWQTHFSNKSSFSIDFHGVGGFIKNSQFGALKIKDAVVDRF
RDDGCPRPDVARVDADFKIDAHYRRGQITLGINFSGPALHQRGYRSTTGEAPLKENLAAN
MLVRSGWQQSPKDLLDPFCGSGTILIEAAMMACDIAPALQRRRFGFEHWLRHQEADWQEL
LAEAKARASIGTKRCEIKFYGSDIDSRLVALAKRNAQNAGVAELIELSVSNALNVTPPVE
QGYLITNPPYGERLGNVTSLLQLYYQLGDKLKAEFGGWQVAVLNSDIELLSALKLKADKQ
MKMYNGALECAFNLYTLHANSTRRLDPSQVLSQGGEVSEVATAFSNRIKKNHKQLSKWAQ
REGIDSYRLYDADIPEYNVAVDIYLDHVVIQEYSAPKSIPEAVTKRRLTDVLLVLPQAIG
VDPDKIILKTRERQKGTNQYQKLDATKLELVTTEYGAKFKLNLKDYLDTGLFLDHRLTRK
LVGEKSKGRDVLNLFAYTGSASVHAALGGAKSVTTVDMSNTYLNWAQDNFELNGLKGKQY
QFIQGDCLQWIDDCDQQYDLIFIDPPTFSNSKRMEDSFDVQRDHVKLLSALVKLLRPGGE
ILFSNNKRKFKMDSEALSALGLSITNLDKQTLPLDYKRNPHIHNTWLIQHA