Protein Info for Shew_1796 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 signal peptide" amino acids 14 to 15 (2 residues), see Phobius details transmembrane" amino acids 16 to 33 (18 residues), see Phobius details PF02470: MlaD" amino acids 41 to 132 (92 residues), 56.7 bits, see alignment E=1.2e-19 amino acids 158 to 214 (57 residues), 30 bits, see alignment 2.5e-11 amino acids 274 to 362 (89 residues), 36.5 bits, see alignment E=2.4e-13 amino acids 390 to 448 (59 residues), 29.7 bits, see alignment 3.1e-11 amino acids 628 to 718 (91 residues), 44.8 bits, see alignment E=6e-16 amino acids 743 to 825 (83 residues), 39.3 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1796)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDW4 at UniProt or InterPro

Protein Sequence (874 amino acids)

>Shew_1796 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MTQIETPKVVKKKLFSPIWLLPLIALALGAWLGIKSIRESGVEVRIHFPSATGIDVGKTL
VRYQGLTVGKVVDISIDDQLQGVYVDLLMDYRSTPFLRDETKFWLVTPKASITGVEGLDA
LFSGNYIAIQPGEGDYKNEFTAEDQAPPVAPGSDGLMIELTSASLGSLDVGSQVFYRQIP
VGKIVSYRLVNDDSILFNAYIEKKYSHLVKQDSRFWNVSGLALDASLSGIKVKTESLSAI
LAGGVSFSSQGSSEQASVNQTFTIFEDKEHALGGITFSLTANDADSLSTGADIVYRGISI
GQITQTHLTEAGVSFDASIATQYAELLGKDSQFWLEGADLSLSGIKHASRLVTGNVVAFL
PGSGEHQTSYPLLAKAPQHSQTPLMLSLSAEENPGISAGAEVRFKQLPIGQVDSVEFKPD
YSGLAYRIQIWPEFAKLIHQGSYFVAESALAIDASLDGVSVNTRDLTTLTKGAISLVQGR
SKRTANPSQSLPLFANTKQAEGDLAKQNRLKIVLSSPDGAGLAAHSPIYYKKMQIGEVQG
VNWRASSEDFAIELGIDKQFASLVKPSTIFWRNGALSVDASLNGVKVDVAPLEGALKGSV
SLGLLEQDDIGNQSHLYGSETLARAKATPISIEFDASTRLSSHAPIRYQGHQIGEVERVK
LSQDLRSVNVDAYLYGDYAVPFLADDAQYFIVDANISLSGVTAAETLITGPYVSVLPGQS
GNQVHDFMGSVESPTLLNQDALTFTLVDDNLGSVKIGTPIIFRGIKIGEVKQVQLSTTGT
QVEITAQIAKGYSHLVNQSSQFWDLSGIKVDVGLFSGAQIETGSLETIIAGGIGVATQSP
TTANNRIGQDQVFSLQSKLDPNWLKWAPNQQSLN