Protein Info for Shew_1772 in Shewanella loihica PV-4

Annotation: NapC/NirT family periplasmic nitrate (or nitrite) reductase c-type cytochrome (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details TIGR02161: periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family" amino acids 5 to 190 (186 residues), 334.7 bits, see alignment E=7.4e-105 PF03264: Cytochrom_NNT" amino acids 15 to 189 (175 residues), 265.4 bits, see alignment E=5.3e-83 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 49 to 183 (135 residues), 30.1 bits, see alignment E=8.4e-11

Best Hits

Swiss-Prot: 70% identical to NAPC_RHOS4: Cytochrome c-type protein NapC (napC) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 100% identity to slo:Shew_1772)

MetaCyc: 59% identical to NapC (Aliivibrio fischeri)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDU0 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Shew_1772 NapC/NirT family periplasmic nitrate (or nitrite) reductase c-type cytochrome (RefSeq) (Shewanella loihica PV-4)
MLDKLKKIWQVLRKPSVHFSLGFLTLGGFVAGVIFWGGFNTALEATNQEAFCIGCHEMEN
NVYQELKSTIHFTNRSGVRATCPDCHVPHNWTDKIARKMQASKEVWGKVFGTINTRDKFE
AKRRELAEHEWARLKANDSLECRNCHNFDYMDFTRQSTRAANMHSTSLASGEKTCIDCHK
GIAHHLPDMKGVEGF