Protein Info for Shew_1739 in Shewanella loihica PV-4

Annotation: DoxX family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details PF07681: DoxX" amino acids 20 to 105 (86 residues), 81.1 bits, see alignment E=3.6e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1739)

Predicted SEED Role

"FIG01057559: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDQ8 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Shew_1739 DoxX family protein (RefSeq) (Shewanella loihica PV-4)
MQKLYAKFTQGIAQLDGVAALALRLYLAPVLMQAGYNKLSHFSDTAAWFGNAEWGLGLPM
PEVMVALAAGSEFVGGFLLILGLATRLISIPLMVTMAVAAFSVHWKNGWLAIADPSSWLA
NEQVMASAEKLAAAKSLLQEHGHYEWLTSSGNFVILNNGIEFAVTYLFMLFALLIIGGGR
YTSLDYWIARKYQPKA