Protein Info for Shew_1721 in Shewanella loihica PV-4

Annotation: methyltransferase type 11 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01209: Ubie_methyltran" amino acids 55 to 168 (114 residues), 27.5 bits, see alignment E=4.9e-10 PF13847: Methyltransf_31" amino acids 77 to 178 (102 residues), 37.7 bits, see alignment E=4.2e-13 PF08242: Methyltransf_12" amino acids 79 to 165 (87 residues), 37.4 bits, see alignment E=9e-13 PF13649: Methyltransf_25" amino acids 79 to 164 (86 residues), 55.8 bits, see alignment E=1.5e-18 PF08241: Methyltransf_11" amino acids 79 to 167 (89 residues), 66.6 bits, see alignment E=6.4e-22

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to slo:Shew_1721)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDP0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Shew_1721 methyltransferase type 11 (RefSeq) (Shewanella loihica PV-4)
MSIKMPSLTPSSLSSLIPSSVPSEVQNVQGKDCMKEAIGADKIARQFSQAAKHYQEHDKV
QRLSAQRLRTKMTPIGRLLDIGCGPGTDFSAAPGLNEVLGLDIAPGMLSQMLESFPSYKA
LCGDAQALPLSDASIDTLYSNLALQWCSDIKTAIGELARVLKPGSQCHLAIVVDGSLSEL
DALGLRVNAFEQAQTLLDGFSDSHWQIEHHSVEPLRVHFDDLKTLLYSIKGVGASAAMGS
DVSQGSDVTQDSDASHGPDDTQGSVSKPPPRLRGRQDWLALCERAEKMRQPEGLPLTYQI
LFIHASRRG