Protein Info for Shew_1716 in Shewanella loihica PV-4

Annotation: 3-beta hydroxysteroid dehydrogenase/isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF01370: Epimerase" amino acids 33 to 258 (226 residues), 110.3 bits, see alignment E=4.1e-35 PF04321: RmlD_sub_bind" amino acids 33 to 184 (152 residues), 40.3 bits, see alignment E=8.4e-14 PF01073: 3Beta_HSD" amino acids 34 to 281 (248 residues), 171.9 bits, see alignment E=6e-54 PF02719: Polysacc_synt_2" amino acids 34 to 140 (107 residues), 28 bits, see alignment E=5.2e-10 PF16363: GDP_Man_Dehyd" amino acids 34 to 361 (328 residues), 50 bits, see alignment E=1.3e-16 PF05368: NmrA" amino acids 34 to 140 (107 residues), 30.1 bits, see alignment E=1.6e-10 PF13460: NAD_binding_10" amino acids 37 to 179 (143 residues), 52.8 bits, see alignment E=1.9e-17 PF07993: NAD_binding_4" amino acids 86 to 183 (98 residues), 31 bits, see alignment E=6.1e-11

Best Hits

Swiss-Prot: 66% identical to OLED_SHEON: 2-alkyl-3-oxoalkanoate reductase (oleD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1716)

MetaCyc: 66% identical to hentriaconta-3,6,9,12,19,22,25,28-octaene-16-one-15-oate reductase (Shewanella oneidensis MR-1)
RXN-18561 [EC: 1.1.1.412]

Predicted SEED Role

"NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.412

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDN5 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Shew_1716 3-beta hydroxysteroid dehydrogenase/isomerase (RefSeq) (Shewanella loihica PV-4)
MSITKHSNHTDNVNLLPEELEALTQLAGLSRHALVTGAGGFLGKAICQRLIAAGIAVTGF
ARGHYPELEAMGVNMVSGDICDLESVTNAMAGCDLVFHVASKAGVWGSKESYFAPNVQGC
DNLLKAAAAHDIDSFVYTSTPSVTFAGEDESGIDERAPYASRFLNYYGESKAIAEQRVTA
ANSTSLSSANSPSEGKLNTVSLRPHLIWGPEDPHLVPRVIARARAGKLKLVGKVDKLVDT
IYVGNAAYAHILAALTLKQNPQQCAGKCYFLSNDEPITMKVILNKILACAELPKVEKRVP
ASVAYLAGALLEGVYGLLGKCDEPIMTRFVARQLSTCHYFDISAAKRDLNYRPLVSIDEG
MVQLSNWLKQEKV