Protein Info for Shew_1714 in Shewanella loihica PV-4

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00561: Abhydrolase_1" amino acids 30 to 275 (246 residues), 115.6 bits, see alignment E=7.7e-37 PF12697: Abhydrolase_6" amino acids 31 to 282 (252 residues), 75.7 bits, see alignment E=2.2e-24 PF12146: Hydrolase_4" amino acids 31 to 275 (245 residues), 39.1 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 81% identical to OLEB_SHEON: Cis-3-alkyl-4-alkyloxetan-2-one decarboxylase (oleB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 100% identity to slo:Shew_1714)

MetaCyc: 81% identical to 3-alkyl-4-acyloxetan-2-one decarboxylase (Shewanella oneidensis MR-1)
RXN-18563 [EC: 4.1.1.114]

Predicted SEED Role

"Haloalkane dehalogenase-like protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.5 or 4.1.1.114

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDN3 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Shew_1714 alpha/beta hydrolase fold (RefSeq) (Shewanella loihica PV-4)
MLDSLFPIKRNYLDRNGHKLQYVNEGQGEPVVMVHGNPSWSFYYRNLVTALSPNHQCIVP
DHIGCGLSDKPDDAGYDYTLKNRIDDLEALLDHLEVKEKITLIVHDWGGMIGMGYAARHP
ERIKKIVVLNTGAFHLPEAKPFPWALWICRNTLLGTVLVRGFNAFSSIASYVGVKRAPMP
KAIREAYVAPFNSWANRISTLRFVQDIPLKPGDRNYELVSEISEKLNQFNQLPMMICWGL
KDFVFDKHFLDEWKRRFPEAEVHEFADCGHYILEDASDEVVAQVQQFMAR