Protein Info for Shew_1680 in Shewanella loihica PV-4

Annotation: HPP family protein+B94 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 87 (28 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details PF04982: TM_HPP" amino acids 4 to 144 (141 residues), 142.9 bits, see alignment E=3.2e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1680)

Predicted SEED Role

"similar to DBJ:BAB55450.1 (AB051073) percent identity 45 in 140 aa"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDJ9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shew_1680 HPP family protein+B94 (RefSeq) (Shewanella loihica PV-4)
MNKLAFALISGLGAALAIGLLSFAETLQSDIVLLMVPFGATAVLVFGVPDSPLAQPKNVI
FGHLLTCAIGLYFVHYVGVSPLTLAIATGLAVSGMLLTKTTHPPAGATPLLVMLTGQDWS
FLVSPVLSGALIIVLVGKLIALMHKRLERQQRAALD