Protein Info for Shew_1670 in Shewanella loihica PV-4

Annotation: enoyl-CoA hydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00378: ECH_1" amino acids 13 to 256 (244 residues), 190.2 bits, see alignment E=4.1e-60 PF16113: ECH_2" amino acids 13 to 194 (182 residues), 88.1 bits, see alignment E=8.7e-29

Best Hits

Swiss-Prot: 39% identical to HPCD_METS5: 3-hydroxypropionyl-coenzyme A dehydratase (Msed_2001) from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to slo:Shew_1670)

MetaCyc: 39% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) / Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDI9 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Shew_1670 enoyl-CoA hydratase (RefSeq) (Shewanella loihica PV-4)
MTAIVEQIIGHTAVLTMNNPPANTWTADSLALLKQKVTELNANKEIYALVLTGEGEKFFS
AGADLKLFADGDKGNAATMAKHFGEAFEALSGFRGVSIAAINGYAMGGGLEVALACDIRI
AEAQAVMALPEATVGLLPCAGGTQNLTAMVGEGWAKRMILCGERVGADKALSIGLIEEVV
DKGAALDTAMALAEKVANQSPSSVTVCKQLIQSGRAMPRTQALPLERELFVGLFDTEDQA
EGVNAFLEKRKANWKNR