Protein Info for Shew_1670 in Shewanella loihica PV-4
Annotation: enoyl-CoA hydratase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to HPCD_METS5: 3-hydroxypropionyl-coenzyme A dehydratase (Msed_2001) from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to slo:Shew_1670)MetaCyc: 39% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]
Predicted SEED Role
"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) / Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 4.2.1.17)
MetaCyc Pathways
- oleate β-oxidation (33/35 steps found)
- superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- fatty acid β-oxidation I (generic) (6/7 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- acrylate degradation II (3/3 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- β-alanine biosynthesis II (5/6 steps found)
- fatty acid salvage (5/6 steps found)
- pyruvate fermentation to butanol II (engineered) (5/6 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
- adipate degradation (4/5 steps found)
- L-valine degradation I (6/8 steps found)
- L-isoleucine degradation I (4/6 steps found)
- valproate β-oxidation (6/9 steps found)
- acrylate degradation I (3/5 steps found)
- adipate biosynthesis (3/5 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- propanoyl-CoA degradation II (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- propanoate fermentation to 2-methylbutanoate (3/6 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- glycerol degradation to butanol (10/16 steps found)
- pyruvate fermentation to butanol I (4/8 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
- benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
- benzoyl-CoA degradation I (aerobic) (2/7 steps found)
- 3-phenylpropanoate degradation (4/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- phenylacetate degradation I (aerobic) (3/9 steps found)
- 2-methylpropene degradation (2/8 steps found)
- superpathway of phenylethylamine degradation (4/11 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- 3-hydroxypropanoate cycle (5/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- glyoxylate assimilation (4/13 steps found)
- L-glutamate degradation VII (to butanoate) (3/12 steps found)
- L-tryptophan degradation III (eukaryotic) (4/15 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
- superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
- platensimycin biosynthesis (6/26 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.17
Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QDI9 at UniProt or InterPro
Protein Sequence (257 amino acids)
>Shew_1670 enoyl-CoA hydratase (RefSeq) (Shewanella loihica PV-4) MTAIVEQIIGHTAVLTMNNPPANTWTADSLALLKQKVTELNANKEIYALVLTGEGEKFFS AGADLKLFADGDKGNAATMAKHFGEAFEALSGFRGVSIAAINGYAMGGGLEVALACDIRI AEAQAVMALPEATVGLLPCAGGTQNLTAMVGEGWAKRMILCGERVGADKALSIGLIEEVV DKGAALDTAMALAEKVANQSPSSVTVCKQLIQSGRAMPRTQALPLERELFVGLFDTEDQA EGVNAFLEKRKANWKNR