Protein Info for Shew_1637 in Shewanella loihica PV-4

Annotation: DNA internalization-related competence protein ComEC/Rec2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 761 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 305 to 338 (34 residues), see Phobius details amino acids 367 to 422 (56 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 452 to 473 (22 residues), see Phobius details amino acids 479 to 497 (19 residues), see Phobius details PF13567: DUF4131" amino acids 23 to 160 (138 residues), 55.8 bits, see alignment E=7.3e-19 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 109 to 723 (615 residues), 376.9 bits, see alignment E=1.6e-116 PF03772: Competence" amino acids 196 to 473 (278 residues), 175.5 bits, see alignment E=2.3e-55 TIGR00360: ComEC/Rec2-related protein" amino acids 218 to 405 (188 residues), 72.4 bits, see alignment E=5.7e-24 PF00753: Lactamase_B" amino acids 512 to 687 (176 residues), 57 bits, see alignment E=4.1e-19

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to slo:Shew_1637)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDF6 at UniProt or InterPro

Protein Sequence (761 amino acids)

>Shew_1637 DNA internalization-related competence protein ComEC/Rec2 (RefSeq) (Shewanella loihica PV-4)
MNRFMFGYCATLISALLWPTLPTFPLACAVLVIAVIMLKWSKLLAGSLLAIAWMSLFCHQ
LLVFTSDKSSEPPSVRGEIISLVYRNGDWINADIRILADHPFHFPDKYLRLRWQSEQKVA
IGEVWQFTLAPKPITSVLNQGEFNQQAYLLSKHIIGKGRVIAAKRLLPPQGMRAKLLTKL
RQDLASLANGDLMLALMLGDKQQISDAHWQGLRQSGTGHLVTISGLHLSVLAIWVMGLGG
YLLGRLTPRLGLGNRQAIALVALICCGLYAFLAGLGLPTQRALIMLVMVILLGLIRRYAS
PFERLLWALFIVLLLDPLSILGAGLWLSFGALAIILWFTQSWPAPDERLSSWQRLKWRLK
QMWQIQWRLSLSLGLLQGLLFGGFAPYALIFNLIFVPWFSLVVIPLSFMALITWIIGIYL
GVSVSLPLYLLDLAISPMTLAFDWLGELPLHWLPASMQLVSALVFGLLGLILWRLASGAW
RWMIPVLFMPLCLWFLPQRLTDPKSWQVHLLDVGQGLSLVVEKQGRALIYDTGAAFGEHF
SYADRVIVPFLHYRGIGELDYLVLSHSDNDHAGGADYLLGRYPKVKLVTDLSYPGAIDCR
PKSLNWQGLRLEILGPREPQPGNNGSCVVRISDGRRSVLIPGDIESEGEQSLLTQSAEVG
STVLIAAHHGSNTSSSGAFIRASAPGIVLYAAGFNNRYGFPKAEVVRRFRDQKALQYSTG
DNGQLSLKLDEQGITVLGYRRDLAPFWYNQRFEFGEFGNPE