Protein Info for Shew_1634 in Shewanella loihica PV-4

Annotation: LolC/E family lipoprotein releasing system, transmembrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 273 to 298 (26 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 355 to 355 (1 residues), see Phobius details amino acids 358 to 370 (13 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 415 (411 residues), 474.6 bits, see alignment E=1.3e-146 PF12704: MacB_PCD" amino acids 27 to 240 (214 residues), 55.8 bits, see alignment E=8.1e-19 PF02687: FtsX" amino acids 277 to 410 (134 residues), 51.9 bits, see alignment E=7.6e-18

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to slo:Shew_1634)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDF3 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Shew_1634 LolC/E family lipoprotein releasing system, transmembrane protein (RefSeq) (Shewanella loihica PV-4)
MRERLAFWVGWRFYMARQSNRFISFISFASTAGIALGVAVLITVLSAMNGFEKELEQRLL
GVVPHGELTGVNEPLHDWPKIAEDAKKIPGINASAPFVRIQGLIQKPGGFQGLTVIGITP
ELEAKVSNIRDFMPDAAWQALASKENNIVLGKGLADALGLSLGNTLSLYTPNLASQSTGR
GLGSAKSHQFKVAGIFALGGELDLTTAYISLDYGAELLGLGDGVSGIRIKVDDVFAAPQL
IRTLGYSQSQYMYLSDWTRTQGHLYQDIQLVRAVMYLVLALVIAVACFNIVSTLVMAVRD
KQSEIAILLTMGMAKATIMGIFVVQGALNGLLGCLIGAGLGITLALNLSAIASGIEQLFG
VQLLSADVYFIDFLPSQLHLLDVALVVSLALLMSLLATLYPAWKASRIHPAEALAGR