Protein Info for Shew_1576 in Shewanella loihica PV-4

Name: dcd
Annotation: deoxycytidine triphosphate deaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR02274: deoxycytidine triphosphate deaminase" amino acids 2 to 190 (189 residues), 217.1 bits, see alignment E=7.3e-69 PF22769: DCD" amino acids 3 to 163 (161 residues), 131.7 bits, see alignment E=5.3e-42 PF06559: DCD_N" amino acids 4 to 139 (136 residues), 34.1 bits, see alignment E=5.1e-12 PF00692: dUTPase" amino acids 82 to 175 (94 residues), 22.6 bits, see alignment E=1.5e-08

Best Hits

Swiss-Prot: 100% identical to DCD_SHELP: dCTP deaminase (dcd) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to slo:Shew_1576)

MetaCyc: 73% identical to dCTP deaminase (Escherichia coli K-12 substr. MG1655)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD95 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Shew_1576 deoxycytidine triphosphate deaminase (RefSeq) (Shewanella loihica PV-4)
MRLTDLEIAACLEEGSIVIDPRPDAEAISGVSVDVKLGNQFRVFQDHTAPYIDLSGPSSE
VQEALDRVMSDKIVIPEGEAFFLHPGELALAVTHESLTLPADIVGWLDGRSSLARLGLMV
HVTAHRIDPGWQGKIVLEFFNSGKLPLALKPMMTIGALNFERLSSPVARPYNKRKSAKYR
DQQEAVASRISQDK