Protein Info for Shew_1574 in Shewanella loihica PV-4

Annotation: ATP-binding Mrp/Nbp35 family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF10609: ParA" amino acids 105 to 349 (245 residues), 330.4 bits, see alignment E=2.3e-102 PF13614: AAA_31" amino acids 108 to 145 (38 residues), 39.5 bits, see alignment 2e-13 PF09140: MipZ" amino acids 109 to 156 (48 residues), 32.9 bits, see alignment 1.6e-11 PF01656: CbiA" amino acids 110 to 327 (218 residues), 49.8 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to slo:Shew_1574)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD93 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Shew_1574 ATP-binding Mrp/Nbp35 family protein (RefSeq) (Shewanella loihica PV-4)
MSSASQNYHLSDDLLGPVLAILDAHQDPYLMQGLVSAGCVTKLDIEGKRLQLGLCYPYPC
QSQYRDTVMAITNKLALLDAIDEVECEIDFQPAVISAGAVEPLPNVKQVIAVASGKGGVG
KSTTSVNLALALAAEGAKVGILDADIYGPSIPLMLGVPNFNPVSPDGKMMTAAEAHGIAA
QSIGFIVSGDEAAVWRGPMAAGALAQLLNETLWPELDYLVIDMPPGTGDIQLTLSQKVPV
SGAVVVTTPQDIALADAKKGISMFQKVNIPVLGIVENMSFHICSDCGHKEHLFGEDGGLK
MAARYNVPLLGQLPLQLNIREDVDKGTPTVVADGESQVALLYKEIARKVGAQLALSQTQS
VVSISISDDE