Protein Info for Shew_1568 in Shewanella loihica PV-4

Annotation: arginyl-tRNA-protein transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF04376: ATE_N" amino acids 17 to 85 (69 residues), 78.3 bits, see alignment E=4.3e-26 PF04377: ATE_C" amino acids 104 to 225 (122 residues), 136.9 bits, see alignment E=5.6e-44

Best Hits

Swiss-Prot: 62% identical to BPT_SHEAM: Aspartate/glutamate leucyltransferase (bpt) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 100% identity to slo:Shew_1568)

MetaCyc: 44% identical to leucylD,E-transferase (Vibrio vulnificus CMCP6)
RXN-17898 [EC: 2.3.2.29]; 2.3.2.29 [EC: 2.3.2.29]

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.29 or 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD87 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Shew_1568 arginyl-tRNA-protein transferase (RefSeq) (Shewanella loihica PV-4)
MNSRSDTIQVGMTHTFDCSYLQGKQEQLLVLQEESLDLTLFEKLLALGFRRSGETIYKPH
CPHCQACLPIRIPVDLFMPSRRQKRTLKQNQDVSWRLVDTCTDEHYALYDRYIKARHHDG
PMYPPSREQYDHFVQCSWHPPKLLELRLEGELIGVAVTDVLPNSLSAIYSFFAPALDKRS
LGSLMILLQCDLARQMHKAHVYLGYQIHESRKMNYKTAYHPYEILTANGWQLSE