Protein Info for Shew_1555 in Shewanella loihica PV-4

Annotation: Glu/Leu/Phe/Val dehydrogenase, dimerisation region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF02812: ELFV_dehydrog_N" amino acids 12 to 130 (119 residues), 100 bits, see alignment E=8.6e-33 PF00208: ELFV_dehydrog" amino acids 146 to 197 (52 residues), 23.7 bits, see alignment 3.7e-09 amino acids 205 to 320 (116 residues), 46.5 bits, see alignment E=3.9e-16

Best Hits

Swiss-Prot: 58% identical to DHLE_BACLI: Leucine dehydrogenase (ldh) from Bacillus licheniformis

KEGG orthology group: K00263, leucine dehydrogenase [EC: 1.4.1.9] (inferred from 100% identity to slo:Shew_1555)

Predicted SEED Role

"Leucine dehydrogenase (EC 1.4.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.4.1.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD74 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Shew_1555 Glu/Leu/Phe/Val dehydrogenase, dimerisation region (RefSeq) (Shewanella loihica PV-4)
MAVFNHISFDDHEQVVFCHDKESGLRAIIAIHNTNLGPAVGGCRMWNYESDDEALTDVLR
LSRGMTYKNALAGLAMGGGKSVIIADPKVENREALFRAFGRCIHTLGGKYYSAEDVGVST
SDIMIAHQETPYMAGLEGQSGDPSPFTALGTYLGIKAAVKHQRGLDSLKGLKIAVQGVGH
VGYYLCRHLHEEGAELIVTDIHQSSLDKVATEFGATVVAPQDIYHQDVDIYAPCALGATI
NDTTIPLLKAKIVAGCANNQLAELRHGEKLKELGILYAPDYVINAGGIINVSFEKDYDAQ
KSTAKVEEIYNTLLKIFEQSDAQNRTTADVADELARAIINGEK