Protein Info for Shew_1529 in Shewanella loihica PV-4

Annotation: TPR repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 31 to 104 (74 residues), 86.4 bits, see alignment E=4.6e-28 TIGR02795: tol-pal system protein YbgF" amino acids 121 to 237 (117 residues), 133.6 bits, see alignment E=2.6e-43 PF13432: TPR_16" amino acids 128 to 184 (57 residues), 37.5 bits, see alignment E=1.1e-12 PF13174: TPR_6" amino acids 129 to 153 (25 residues), 19.4 bits, see alignment (E = 5.2e-07) amino acids 159 to 190 (32 residues), 16 bits, see alignment 6.5e-06 amino acids 195 to 227 (33 residues), 25.1 bits, see alignment 8e-09 PF14559: TPR_19" amino acids 131 to 190 (60 residues), 30.3 bits, see alignment E=1.7e-10 PF13181: TPR_8" amino acids 157 to 184 (28 residues), 13.8 bits, see alignment (E = 2.2e-05) amino acids 195 to 222 (28 residues), 14.3 bits, see alignment (E = 1.5e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1529)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD48 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Shew_1529 TPR repeat-containing protein (RefSeq) (Shewanella loihica PV-4)
MKTAVVTAAILMSVGVAVAAPAPVEDVAGGSSEDRVARLERIIKAKQAAEFEMQQRLDTL
QQEVLDLRGLTEQQSYQINQMLQRQRQLYDDIANLSKAKSTPVAATPVATSSETSSLGET
ASYERAVNLVLKERQYDEAIPAFREFIAQYPNSTYAANANYWLGQLLYNKGELAEAGKAF
NTVVNQFKESNKRGDSLVKLGMIAQKRNDNAAAKRYYQQVVSEYANSAAARIAKQQMVGL