Protein Info for Shew_1527 in Shewanella loihica PV-4

Annotation: TolB domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 15 to 438 (424 residues), 547.8 bits, see alignment E=8.3e-169 PF04052: TolB_N" amino acids 23 to 126 (104 residues), 101.2 bits, see alignment E=7e-33 PF07676: PD40" amino acids 206 to 238 (33 residues), 31.6 bits, see alignment (E = 2.5e-11) amino acids 248 to 283 (36 residues), 39.2 bits, see alignment 1e-13 amino acids 292 to 327 (36 residues), 50.8 bits, see alignment 2.4e-17 amino acids 336 to 369 (34 residues), 20.9 bits, see alignment 5.5e-08 PF00930: DPPIV_N" amino acids 260 to 358 (99 residues), 23.1 bits, see alignment E=5.7e-09

Best Hits

Swiss-Prot: 100% identical to TOLB_SHELP: Tol-Pal system protein TolB (tolB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to slo:Shew_1527)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD46 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Shew_1527 TolB domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MKNLGRWLILGLAFLTIPAKAALDIVITEGVDAARPIAVVPFVWQGSTPMPQQISDVVMS
DLTRSGTFKPMDELGLPQRNLGSLAQMDLKAWSNVAAEAVVMGTVKPYGPDQYLVNFELI
DLVKAQMQSGGPQSASEYLLDSRETVISSAQFRQYGHRISDIVYEKLTGIRGAFLTRIAY
VVVDHKAKSPYKLMIADYDGYNEQMLLRSPEPLMSPAWSPDGRRLAYVSFENKQAEVFVQ
DIYTQQRTKVTSFPGINGAPTFSPDGKKLALTLSKDGQPEIYVADIATKAIKRVTNHYAI
DTEASWTPDGKSLIFTSERGGRPQIYQVALASGKVTRLTFEGEWNLGGSISPDGRSMVFV
NRTNGKFNIARMDLETRFMQVLTTTRLDESPSIAPNGTMVIYGTTYQGQQVLAAVSMDGR
FKARLPVGQGEVKSPAWSPFL