Protein Info for Shew_1524 in Shewanella loihica PV-4

Annotation: MotA/TolQ/ExbB proton channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 6 to 220 (215 residues), 305.8 bits, see alignment E=9.2e-96 PF01618: MotA_ExbB" amino acids 77 to 207 (131 residues), 135.8 bits, see alignment E=3.5e-44

Best Hits

Swiss-Prot: 62% identical to TOLQ_SHIFL: Tol-Pal system protein TolQ (tolQ) from Shigella flexneri

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 100% identity to slo:Shew_1524)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD43 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Shew_1524 MotA/TolQ/ExbB proton channel (RefSeq) (Shewanella loihica PV-4)
MEADISFIGLFLQASLLVKFVMLTLLALSVVSWAVIIQRRRLLTSARQRSLKFEDKFWSG
VDLNKLYKELSARQESNTGLEAMFYAGFKEYARLSNLNGKVPAAVMDGCYRAMRVSLSRE
LEKLETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATA
MGLFAAIPAVIAYNRFSTQVEKIEMSYANFMEEFSSILHRQAYSEKEVG