Protein Info for Shew_1521 in Shewanella loihica PV-4

Annotation: OmpA/MotB domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF18393: MotY_N" amino acids 20 to 167 (148 residues), 177.2 bits, see alignment E=2.3e-56 PF00691: OmpA" amino acids 179 to 275 (97 residues), 63.8 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 45% identical to MOTY_VIBPA: Sodium-type flagellar protein MotY (motY) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1521)

Predicted SEED Role

"Sodium-type flagellar protein MotY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD40 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Shew_1521 OmpA/MotB domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MTFGIGLSLATTAQAELRHYVASLEQSSWRLSGNTPIICRLEHEIPSYGKAVFTSRAGKD
HDLNFSLDMWVKPDEVTSAKLMSMAPAWRPGVVSRPITDLTYQKYFSGEVPKKAAWSMLN
ELERGMQPTFYYADWYNRSSKVAVGLSAANFGRRYAEFKSCLANLLPYSFDDIAFTVLTY
EFGGSELTRYSKAQIAKVQEYLSYDPEVELVLIDAYTDSFGGRSVNKKVSEKRANSVKQL
FLSAGIPNERIHTYGHGERRHVASNDTIDERARNRRVVIRLSKPLD