Protein Info for Shew_1520 in Shewanella loihica PV-4

Annotation: ribonuclease T (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR01298: ribonuclease T" amino acids 30 to 228 (199 residues), 327.6 bits, see alignment E=1.4e-102 PF00929: RNase_T" amino acids 40 to 214 (175 residues), 93.8 bits, see alignment E=8.9e-31

Best Hits

Swiss-Prot: 85% identical to RNT_SHEON: Ribonuclease T (rnt) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 100% identity to slo:Shew_1520)

MetaCyc: 69% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD39 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Shew_1520 ribonuclease T (RefSeq) (Shewanella loihica PV-4)
MTSSHRILHNSPPLFTLDILMSDICDAHKLKHRFRGYFPVVIDVETAGFNAQTDALLEIA
VTLLKMDDNGDLVLDKTLHYHIEPFEGANLEPEALAFNGIDPSNPLRGAVSEKEAFLEIF
KEVKKHQKASNCHRSIIVAHNAAFDHGFVTQAIERNALKRTPFHPFATFDTAALSGLALG
HTVLAKACEIAGIPFDNKEAHSALYDTERTAELFCHIVNKWKALGGWPVATPSEETGSDE
AASEPASGQDTDTSANC