Protein Info for Shew_1497 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details PF07556: DUF1538" amino acids 21 to 241 (221 residues), 245.1 bits, see alignment E=2.4e-77

Best Hits

Swiss-Prot: 61% identical to UMPA_HALZH: Na(+), Li(+), K(+)/H(+) antiporter subunit A (umpA) from Halomonas zhaodongensis

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1497)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD16 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Shew_1497 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSALLSLFRSLLGSFRDLVPIICVVAFFEIFVLHQAPANLAEILLGLVFIVFGLTFFVFG
LEMGLFPIGESLAQALARKGSVFWLVVFSFSLGFGTTLAEPALTAVANEAAEVAANSGAI
AASQDAMDSYAMGLRLTVAISVGLAILLGVIRILKGWPIHYLIIGGYLCVMVLTAFAPEN
IIGIAYDSGGVTTSTITVPLVTALGVGLASVIKGRNPMLDGFGLIAFASLTPMIFVLLYG
MWVL