Protein Info for Shew_1492 in Shewanella loihica PV-4

Annotation: MATE efflux family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 270 to 296 (27 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 28 to 404 (377 residues), 185.3 bits, see alignment E=8.9e-59 PF01554: MatE" amino acids 28 to 182 (155 residues), 93.7 bits, see alignment E=5e-31 amino acids 241 to 401 (161 residues), 69.2 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1492)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QD11 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Shew_1492 MATE efflux family protein (RefSeq) (Shewanella loihica PV-4)
MTTAKFVQGSIMRHILVMSSTAAIGISALFVVDLIDIFFLSLLGEQELAAAVGYAGTISF
FTTSIGIGLSIALGALVSRAVGAKEFELAKRLLLNSAVVTVLVASVVAIIVTCFIPELLT
LVGATGRTGELAAGYLYILVPSMPIICLAMALGAALRAVGDAKLSMVSTLTGGGVNLVFD
PIFIFLLAMGIEGAALASVLARLAVLLVAARGVVVKHKLFGRFDLTAFKEDIKPIFAIAG
PAMMTNIATPIGNAVVTRAIAEFGDSYVAAWAVLGRLTPVAFGMIFALSGAIGPIVGQNF
GAREFARVRQSLTKALQFCALYVVTVSLLLMLLQEQIVALFAMQGESAELIRFFCRYIAV
FFVFSGALFVANASFNNLGKAKYSTLFNVGKATLGTIPFVYYGGQLGGVEGVLIGQVLGA
ILFGVLGVLTAYRLVDKVQASAVPVVSQEVLDEELSPSSPNPLSSSCAQMAQLSEEQDCE
ESNRVSELVTGPGRD