Protein Info for Shew_1446 in Shewanella loihica PV-4

Updated annotation (from data): dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), solute receptor component
Rationale: Important for utilizing succinate, fumarate, and L-malate, as expected, and also for utilizing a-ketoglutarate
Original annotation: TRAP dicarboxylate transporter, DctP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF03480: DctP" amino acids 38 to 320 (283 residues), 335.4 bits, see alignment E=1.4e-104 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 38 to 283 (246 residues), 256.3 bits, see alignment E=1.6e-80

Best Hits

Swiss-Prot: 100% identical to DCTP_SHELP: Solute-binding protein Shew_1446 (Shew_1446) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 100% identity to slo:Shew_1446)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCW5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Shew_1446 dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), solute receptor component (Shewanella loihica PV-4)
MTRLNTCTFIKQIVKMTSIAALLGASLNSWAAPTEIKFSHVVAENTPKGQMALKFKQLVE
ERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFVAPSLSKFERYTKKLQLFDLPFLFKD
MDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGMKQFSASSPLVLPEDAQGKKFRIMAS
DVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQSNITESNHGV
LDYMVVTSNTFWKSLPADKRKVIKASLDEAIAYGNEIAAAKVNKDKQAIIDSKRSEVTYL
TPEQRAAWVNAMKPVWAQFEDKIGKDLIDAAVASNE