Protein Info for Shew_1424 in Shewanella loihica PV-4

Annotation: TrkA domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 27 to 44 (18 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details amino acids 469 to 488 (20 residues), see Phobius details amino acids 496 to 496 (1 residues), see Phobius details amino acids 500 to 533 (34 residues), see Phobius details amino acids 553 to 573 (21 residues), see Phobius details PF03600: CitMHS" amino acids 29 to 520 (492 residues), 155.8 bits, see alignment E=2.4e-49 PF02080: TrkA_C" amino acids 211 to 276 (66 residues), 31.7 bits, see alignment E=1.7e-11 amino acids 294 to 352 (59 residues), 30.6 bits, see alignment 3.9e-11 PF00939: Na_sulph_symp" amino acids 410 to 569 (160 residues), 31.9 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1424)

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCU3 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Shew_1424 TrkA domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MTFNAYLTIAIFLATIVGLVRFQNRPALVFGVTLLVLVAFNLVTKEQLLSSMSNPGLVTL
VLLILCSFALEKTRLLRVIAAKVIVSGYRTTWLRLYGMTALSSALLNNTAVVATLLSPIR
NNPHHVASKLLLPLSYAAILGGTLTLVGTSTNLIVNSMVIDASNQSLSFFSFTAIGALLV
LGCGLVLRIASRWLPDIAHQETCSKGYFIDAKVVAGSELIGRSVEDNGLRHLESLFLVEV
VRNGRLISPVTPTEVLQQDDRLIFSGDIAKVMQLSQFSGLEMFAEKNGLLDSNLTEVVVK
QESVLVGKTMKKAGFRALFDAAAVAIRRDGEEISGKLGEVQIKAGDFLVLAVGKDFLTRH
NISKNFIVISGVEPETRNNGKKAWISIGGFVLTLVLAATGVVEMLQGMLLLLGVLIFTQC
LNVNEVVRRFPVDIWLVVASAILLSHALVNSGVAELVASWVEGTAEKEHLMLALLLVYLA
TWLMTELITNNAAAALMFPIAYSIALGFGVDFLPFVMTVAFAASGSFISPYGYQTNLMVY
NAGRYRLMDFVKVGVPVSLTYGAIVLLTVPLFFPF