Protein Info for Shew_1410 in Shewanella loihica PV-4

Annotation: glycosyl transferase, group 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 84 to 99 (16 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 18 to 190 (173 residues), 42.1 bits, see alignment E=2.5e-14 PF00534: Glycos_transf_1" amino acids 195 to 361 (167 residues), 98.1 bits, see alignment E=1.1e-31 PF20706: GT4-conflict" amino acids 201 to 322 (122 residues), 35.3 bits, see alignment E=1.7e-12 PF13692: Glyco_trans_1_4" amino acids 204 to 341 (138 residues), 77.6 bits, see alignment E=3.1e-25 PF13524: Glyco_trans_1_2" amino acids 233 to 376 (144 residues), 29.4 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1410)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCT1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Shew_1410 glycosyl transferase, group 1 (RefSeq) (Shewanella loihica PV-4)
MSLKMKLIYVVESSVPYGANKCLIEIIDRLDKDKHEVMVVGADEGALSSWLRERNVSYVS
LNHRLSIYPVLNSRKDYLLWLPRLFRRVALNVIAMVKFFKICKRFKPDIVHTNVGPCSLG
YFVATYLGIKHVWHVREYQDLDFGMSFFPNRKAFLKRLKRSDAVICITNSIAAHFHLTDN
ENLAVINDGVISDEKEIDIIQKENYFLFAGRLEAAKGIEEAIESFFEFCETDSSGISFYV
AGDGNFNYLKKLKEKVSKSNFSNRVRFLGFRDDIFALMRMAKALVVASRCEGFGLITAEA
MYQGTLVIGRDTGGTSEILKDSKGIHYGFLFNSIDELTKLMHEVVDLSPDEYTKMARSAQ
RRTLDKYTINRNFREISDVYNTLM