Protein Info for Shew_1382 in Shewanella loihica PV-4

Annotation: cobyrinic acid a,c-diamide synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF13614: AAA_31" amino acids 31 to 187 (157 residues), 70.3 bits, see alignment E=7.3e-23 PF06564: CBP_BcsQ" amino acids 31 to 173 (143 residues), 29.9 bits, see alignment E=1.4e-10 PF10609: ParA" amino acids 31 to 270 (240 residues), 82.2 bits, see alignment E=1.4e-26 PF09140: MipZ" amino acids 32 to 208 (177 residues), 32.3 bits, see alignment E=2.4e-11 PF01656: CbiA" amino acids 33 to 249 (217 residues), 60.5 bits, see alignment E=5.8e-20 PF02374: ArsA_ATPase" amino acids 35 to 68 (34 residues), 34.1 bits, see alignment 6.5e-12 PF00142: Fer4_NifH" amino acids 37 to 274 (238 residues), 45.3 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to slo:Shew_1382)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCQ3 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Shew_1382 cobyrinic acid a,c-diamide synthase (RefSeq) (Shewanella loihica PV-4)
MNRPTHLSNIMSRDQASGLRMMNQPYNEKVKVIAVTGGKGGVGKTSVSINTAVSLAEKGK
RVLVLDADLGLANVDVMLGLRAERNLSHVLSGDADLDDIIVRGPKGIGIIPATSGTQAMV
ELTPAQHAGLIRAFSEMKTQFDILVVDTAAGISDMVLSFSRASQDVLVVVCDEPTSITDA
YALIKILSREHGVFRFKIVANMVRSLREGMELFAKLSKVTDRFLDVALELVATIPFDENL
RKSVRKQKLIVEAFPKSPASIAYHGLANKIISWPVPQQPGGHLEFFVERLVQRPEYQEDR
TSE