Protein Info for Shew_1362 in Shewanella loihica PV-4

Annotation: sigma-54 dependent trancsriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF06490: FleQ" amino acids 7 to 112 (106 residues), 110.3 bits, see alignment E=1.9e-35 PF00158: Sigma54_activat" amino acids 134 to 300 (167 residues), 247.1 bits, see alignment E=2.2e-77 PF14532: Sigma54_activ_2" amino acids 135 to 305 (171 residues), 59.5 bits, see alignment E=1.4e-19 PF07728: AAA_5" amino acids 158 to 276 (119 residues), 28.3 bits, see alignment E=4.8e-10 PF25601: AAA_lid_14" amino acids 307 to 380 (74 residues), 71.9 bits, see alignment E=9.4e-24 PF02954: HTH_8" amino acids 432 to 472 (41 residues), 46.4 bits, see alignment 7.7e-16

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 100% identity to slo:Shew_1362)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QCN3 at UniProt or InterPro

Protein Sequence (477 amino acids)

>Shew_1362 sigma-54 dependent trancsriptional regulator (RefSeq) (Shewanella loihica PV-4)
MMQTDQRILLVGNQSERINRLSCVFEFLGEQVELLAVDRLESRMSNTRYRALVIAQEAQS
KTLLQSIATSMPWQPILLLGSNGDVTAGNVLGCIEEPLNYPQLTELLHFCQVFVQAKRPD
IPTSGNQTKLFRSLVGRSEGIAQVRHLINQVAGSDATVLVLGQSGTGKEVVARNIHYISD
RRDGPFIPVNCGAIPPELLESELFGHEKGSFTGAISARKGRFELAEGGTLFLDEIGDMPL
QMQVKLLRVLQERVFERVGGSKPIHTNVRVIAATHRELETMIANGEFREDLFYRLNVFPV
EMPALCERKDDIPLLLQELVSRVYNEGRGKVRFTQRAIESLKEHSWSGNVRELSNLVERL
TILYPGGLVDVNDLPLKYRHIDVPEYQVQVSEEELERDALASIFSDEVAVDIPESRFPSE
LPPEGVNLKDLLAELEIDMIRQALDQQDNVVARAAEMLGIRRTTLVEKMRKYGMSKD